[jfarlow]

Here's the full sequence of the protein, found in the supplement [1]

KSSEPASVSAAERRAETEQHKLEQENPGIVWLDQHGRVTAENDVALQILGPAGEQSLGVAQDSLEGIDVVQLHPEKSRDKLRFLLQSKDVGGSPVKSPPPVAMMINIPDRILMIKVSSMIAAGGASGTSMIFYDVTDLTTEPSGLPAGGSAPSHHHHHH

It is a protein encoding the PxRcoM-1 heme binding domain with C94S mutation and a C-terminal 6xHis tag (RcoM-HBD-C94S)

[1] https://www.pnas.org/doi/10.1073/pnas.2501389122#supplementa...

[meisel]

Thanks for that sequence, I can really picture it now

[dekhn]

You can search for it here: https://alphafold.ebi.ac.uk/search/sequence/KSSEPASVSAAERRAE... and in principle get the AlphaFold predicted structure (I couldn't find an experimentally determined one). However, like nearly all EBI resources, the web server timed out before I could get a link to the prediction.

[immibis]

Isn't it strange to see protein codes spreading the same way magnet links or AACS encryption keys might.

[winocm]

If you want to download SARS-CoV-2, here you go: https://www.ncbi.nlm.nih.gov/nuccore/NC_045512.2

[mhb]

That doesn't look right. I think the problem is in the last quarter. Exercise for the reader.

[sunrunner]

This looks like an puzzle input to a day from Advent of Code.

[BurningFrog]

How hard is it to manufacture once you know the sequence?